Pro-neuropeptide Y

Details

Name
Pro-neuropeptide Y
Synonyms
  • CPON
Gene Name
NPY
Organism
Humans
Amino acid sequence
>lcl|BSEQ0019427|Pro-neuropeptide Y MLGNKRLGLSGLTLALSLLVCLGALAEAYPSKPDNPGEDAPAEDMARYYSALRHYINLIT RQRYGKRSSPETLISDLLMRESTENVPRTRLEDPAMW
Number of residues
97
分子量
10851.29
Theoretical pI
7.34
GO Classification
Functions
calcium channel regulator activity/G-protein coupled receptor activity/neuropeptide hormone activity/neuropeptide Y receptor binding/receptor binding
Processes
adult feeding behavior/antibacterial humoral response/antifungal humoral response/behavior/blood circulation/calcium ion transport/cell proliferation/central nervous system neuron development/cerebral cortex development/国防部回应革兰氏阴性bacterium/defense response to Gram-positive bacterium/digestion/feeding behavior/G-protein coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger/innate immune response/movement of cell or subcellular component/neuron projection development/neuropeptide signaling pathway/positive regulation of appetite/regulation of appetite/regulation of blood pressure/response to yeast/synaptic transmission
Components
cell/extracellular region/extracellular space/Golgi apparatus
通用函数
Receptor binding
Specific Function
NPY is implicated in the control of feeding and in secretion of gonadotrophin-release hormone.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Secreted
Gene sequence
>lcl|BSEQ0019428|Pro-neuropeptide Y (NPY) ATGCTAGGTAACAAGCGACTGGGGCTGTCCGGACTGACCCTCGCCCTGTCCCTGCTCGTG TGCCTGGGTGCGCTGGCCGAGGCGTACCCCTCCAAGCCGGACAACCCGGGCGAGGACGCA CCAGCGGAGGACATGGCCAGATACTACTCGGCGCTGCGACACTACATCAACCTCATCACC AGGCAGAGATATGGAAAACGATCCAGCCCAGAGACACTGATTTCAGACCTCTTGATGAGA GAAAGCACAGAAAATGTTCCCAGAACTCGGCTTGAAGACCCTGCAATGTGGTGA
Chromosome Location
7
Locus
Not Available
External Identifiers
Resource Link
UniProtKB ID P01303
UniProtKB Entry Name NPY_HUMAN
GenBank Gene ID BC029497
GenAtlas ID NPY
HGNC ID HGNC:7955
一般References
  1. Minth CD, Bloom SR, Polak JM, Dixon JE: Cloning, characterization, and DNA sequence of a human cDNA encoding neuropeptide tyrosine. Proc Natl Acad Sci U S A. 1984 Jul;81(14):4577-81. [Article]
  2. Minth CD, Andrews PC, Dixon JE: Characterization, sequence, and expression of the cloned human neuropeptide Y gene. J Biol Chem. 1986 Sep 15;261(26):11974-9. [Article]
  3. Takeuchi T, Gumucio DL, Yamada T, Meisler MH, Minth CD, Dixon JE, Eddy RE, Shows TB: Genes encoding pancreatic polypeptide and neuropeptide Y are on human chromosomes 17 and 7. J Clin Invest. 1986 Mar;77(3):1038-41. [Article]
  4. Hillier LW, Fulton RS, Fulton LA, Graves TA, Pepin KH, Wagner-McPherson C, Layman D, Maas J, Jaeger S, Walker R, Wylie K, Sekhon M, Becker MC, O'Laughlin MD, Schaller ME, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Cordes M, Du H, Sun H, Edwards J, Bradshaw-Cordum H, Ali J, Andrews S, Isak A, Vanbrunt A, Nguyen C, Du F, Lamar B, Courtney L, Kalicki J, Ozersky P, Bielicki L, Scott K, Holmes A, Harkins R, Harris A, Strong CM, Hou S, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Leonard S, Rohlfing T, Rock SM, Tin-Wollam AM, Abbott A, Minx P, Maupin R, Strowmatt C, Latreille P, Miller N, Johnson D, Murray J, Woessner JP, Wendl MC, Yang SP, Schultz BR, Wallis JW, Spieth J, Bieri TA, Nelson JO, Berkowicz N, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Bedell JA, Mardis ER, Clifton SW, Chissoe SL, Marra MA, Raymond C, Haugen E, Gillett W, Zhou Y, James R, Phelps K, Iadanoto S, Bubb K, Simms E, Levy R, Clendenning J, Kaul R, Kent WJ, Furey TS, Baertsch RA, Brent MR, Keibler E, Flicek P, Bork P, Suyama M, Bailey JA, Portnoy ME, Torrents D, Chinwalla AT, Gish WR, Eddy SR, McPherson JD, Olson MV, Eichler EE, Green ED, Waterston RH, Wilson RK: The DNA sequence of human chromosome 7. Nature. 2003 Jul 10;424(6945):157-64. [Article]
  5. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
  6. Allen JM, Polak JM, Bloom SR: Presence of the predicted C-flanking peptide of neuropeptide Y (CPON) in tissue extracts. Neuropeptides. 1985 Apr;6(2):95-100. [Article]
  7. Keane FM, Nadvi NA, Yao TW, Gorrell MD: Neuropeptide Y, B-type natriuretic peptide, substance P and peptide YY are novel substrates of fibroblast activation protein-alpha. FEBS J. 2011 Apr;278(8):1316-32. doi: 10.1111/j.1742-4658.2011.08051.x. Epub 2011 Mar 9. [Article]
  8. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. [Article]
  9. Darbon H, Bernassau JM, Deleuze C, Chenu J, Roussel A, Cambillau C: Solution conformation of human neuropeptide Y by 1H nuclear magnetic resonance and restrained molecular dynamics. Eur J Biochem. 1992 Oct 15;209(2):765-71. [Article]
  10. Monks SA, Karagianis G, Howlett GJ, Norton RS: Solution structure of human neuropeptide Y. J Biomol NMR. 1996 Dec;8(4):379-90. [Article]
  11. Barnham KJ, Catalfamo F, Pallaghy PK, Howlett GJ, Norton RS: Helical structure and self-association in a 13 residue neuropeptide Y Y2 receptor agonist: relationship to biological activity. Biochim Biophys Acta. 1999 Nov 16;1435(1-2):127-37. [Article]

Drug Relations

Drug Relations
DrugBank ID Name Drug group Pharmacological action? Actions Details
DB02952 2-aminoisobutyric acid experimental unknown Details
DB03380 L-tyrosinamide experimental unknown Details
DB00191 Phentermine approved, illicit yes inhibitor Details