Reaction center protein H chain
Details
- Name
- Reaction center protein H chain
- Synonyms
-
- Photosynthetic reaction center H subunit
- Gene Name
- puhA
- Organism
- Rhodobacter sphaeroides
- Amino acid sequence
-
>lcl|BSEQ0017273|Reaction center protein H chain MVGVTAFGNFDLASLAIYSFWIFLAGLIYYLQTENMREGYPLENEDGTPAANQGPFPLPK PKTFILPHGRGTLTVPGPESEDRPIALARTAVSEGFPHAPTGDPMKDGVGPASWVARRDL PELDGHGHNKIKPMKAAAGFHVSAGKNPIGLPVRGCDLEIAGKVVDIWVDIPEQMARFLE VELKDGSTRLLPMQMVKVQSNRVHVNALSSDLFAGIPTIKSPTEVTLLEEDKICGYVAGG LMYAAPKRKSVVAAMLAEYA
- Number of residues
- 260
- 分子量
- 28035.115
- Theoretical pI
- 6.25
- GO Classification
-
Functionsbacteriochlorophyll binding/electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activityProcessesoxidation-reduction process/photosynthesis, light reaction/protein-chromophore linkageComponentsintegral component of membrane/plasma membrane light-harvesting complex/plasma membrane-derived chromatophore membrane
- General Function
- Electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
- Specific Function
- The reaction center is a membrane-bound complex that mediates the initial photochemical event in the electron transfer process of photosynthesis.
- Pfam Domain Function
- Transmembrane Regions
- 12-31
- Cellular Location
- Cellular chromatophore membrane
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
-
Resource Link UniProtKB ID P0C0Y7 UniProtKB Entry Name RCEH_RHOSH GenBank Protein ID 152023 GenBank Gene ID M18412 - General References
-
- Williams JC, Steiner LA, Feher G: Primary structure of the reaction center from Rhodopseudomonas sphaeroides. Proteins. 1986 Dec;1(4):312-25. [Article]
- Chang CH, el-Kabbani O, Tiede D, Norris J, Schiffer M: Structure of the membrane-bound protein photosynthetic reaction center from Rhodobacter sphaeroides. Biochemistry. 1991 Jun 4;30(22):5352-60. [Article]
- Allen JP, Feher G, Yeates TO, Komiya H, Rees DC: Structure of the reaction center from Rhodobacter sphaeroides R-26: protein-cofactor (quinones and Fe2+) interactions. Proc Natl Acad Sci U S A. 1988 Nov;85(22):8487-91. [Article]
- Allen JP, Feher G, Yeates TO, Komiya H, Rees DC: Structure of the reaction center from Rhodobacter sphaeroides R-26: the protein subunits. Proc Natl Acad Sci U S A. 1987 Sep;84(17):6162-6. [Article]
- McAuley-Hecht KE, Fyfe PK, Ridge JP, Prince SM, Hunter CN, Isaacs NW, Cogdell RJ, Jones MR: Structural studies of wild-type and mutant reaction centers from an antenna-deficient strain of Rhodobacter sphaeroides: monitoring the optical properties of the complex from bacterial cell to crystal. Biochemistry. 1998 Apr 7;37(14):4740-50. [Article]